DBD: Transcription factor prediction database

Release 2.0
www.transcriptionfactor.org
Sequence ID search:
Genome: Bacillus cereus ssp. cytotoxis NVH 391-98 Sequence ID: gi|152974669|ref|YP_001374186.1|
Details Genome DB Domain architecture
External link 0w SF No hits
  0w PF
Pfam (PF) domains
Family name Family Regions Evalue
ComK protein ComK 6-188 5.2e-43

Similar transcription factor domain architectures

The domain architectures on these pages may take several minutes to generate. Please be patient.

SUPERFAMILY domain architecture does not contain a sequence specific DNA-binding domain.
Predicted transcription factors with similar Pfam domain combinations.

DNA-binding domain taxonomic distribution

Links to external data on the distribution of DBDs across the tree of life.

No SUPERFAMILY sequence specific DNA-binding domains.
Distribution of ComK protein DBDs throughout the species in UniProt.

Sequence
MDGRAERYVENYVINKKTMALLPVILGEKNVITRVIEVEDSFFMFQKPLDIVERSCRKHGSSFLGRKEGT
KELTRITHKAPIAISPTDQLYFFPTYSYSRKECAWLSHFHIASNKELADGNLIIRFINGFAVKLEMSKSS
FENQQNRTAKLRTEYEDRKDKQGNLQFKPVAKEAISTLRPAYEKVYLVKEEDIEGE