DBD: Transcription factor prediction database

Release 2.0
www.transcriptionfactor.org
Sequence ID search:
Genome: Roseobacter denitrificans OCh 114 Sequence ID: gi|110678147|ref|YP_681154.1|
Details Genome DB Domain architecture
External link 2r SF
  2r PF
SUPERFAMILY (SF) domains
Family name Family Regions Evalue
cAMP-binding domain-like 51206 15-146 8.5e-20
"Winged helix" DNA-binding domain 46785 152-217 9.4e-08
Pfam (PF) domains
Family name Family Regions Evalue
Cyclic nucleotide-binding domain cNMP_binding 27-121 2e-09
Bacterial regulatory proteins, crp family Crp 167-198 4e-06

Similar transcription factor domain architectures

The domain architectures on these pages may take several minutes to generate. Please be patient.

Predicted transcription factors with similar SUPERFAMILY domain combinations.
Predicted transcription factors with similar Pfam domain combinations.

DNA-binding domain taxonomic distribution

Links to external data on the distribution of DBDs across the tree of life.

Distribution of "Winged helix" DNA-binding domain DBDs throughout the major taxonomic superkingdoms and kingdoms.
Distribution of Bacterial regulatory proteins, crp family DBDs throughout the species in UniProt.

Sequence
MIADWTERFQGTAALPRAVRDRLSKVARKIELPAGAQVFGPTNIPDSLFFLYDGRIRVSQSSDTGRDIVL
YRVDAGESCVLTTACMLAEEAYNAEGIAETDITAIVLPKLAFDRLVAEEEAFRKFVFAAYSRRLIDLLRV
VDDVAFGHMDVRLAERLLTLAGDFKEVAATHQQLASELGTAREVISRILQDFQKREMIAQSRGRIALLDK
PALKALAASA