DBD: Transcription factor prediction database

Release 2.0
www.transcriptionfactor.org
Sequence ID search:
Genome: Campylobacter curvus 525.92 Sequence ID: gi|154174930|ref|YP_001407338.1|
Details Genome DB Domain architecture
External link 3y SF
  3y PF
SUPERFAMILY (SF) domains
Family name Family Regions Evalue
Regulatory protein AraC 51215 55-164 1.1e-16
Pfam (PF) domains
Family name Family Regions Evalue
Cupin domain Cupin_2 75-145 0.000137

Similar transcription factor domain architectures

The domain architectures on these pages may take several minutes to generate. Please be patient.

Predicted transcription factors with similar SUPERFAMILY domain combinations.
Pfam domain architecture does not contain a sequence specific DNA-binding domain.

DNA-binding domain taxonomic distribution

Links to external data on the distribution of DBDs across the tree of life.

Distribution of Regulatory protein AraC DBDs throughout the major taxonomic superkingdoms and kingdoms.
No PFAM sequence specific DNA-binding domains.

Sequence
MEQVRFAKRSFKKQVFCLKQSQNKGAKMSDRKDQILTKKEELKIYDGVSSEIFAGGLPRVTLLFAATSHA
NVGAALVSFPKGVRTAWHTHPAGQNLIVTKGKIYTGTASGVVQIARVGDVVLCPPDVKHWHGAGLDEGGE
HIAVTFEKDGRNVVWLEHLSQDEYENFVKLANERENDI