DBD: Transcription factor prediction database

Release 2.0
www.transcriptionfactor.org
Sequence ID search:
Genome: Ostreococcus sp. RCC809 Sequence ID: jgi|OstRCC809_1|16248|gw1.16.558.1
Details Genome DB Domain architecture
External link o8 SF
  o8 PF No hits
SUPERFAMILY (SF) domains
Family name Family Regions Evalue
ssDNA-binding transcriptional regulator domain 54447 1-154 5.48e-25

Similar transcription factor domain architectures

The domain architectures on these pages may take several minutes to generate. Please be patient.

Predicted transcription factors with similar SUPERFAMILY domain combinations.
Pfam domain architecture does not contain a sequence specific DNA-binding domain.

DNA-binding domain taxonomic distribution

Links to external data on the distribution of DBDs across the tree of life.

Distribution of ssDNA-binding transcriptional regulator domain DBDs throughout the major taxonomic superkingdoms and kingdoms.
No PFAM sequence specific DNA-binding domains.

Sequence
YVDYGIFKSKAAMKLKAVRPTFETDANGRKIMKRAGGVLLELANAASAGSRSYDWTNKSSFMLSGTEAAE
LADRLASDGACSFFHDPNAGSANRGSVNKAFKVEPMPDGSGGVFVNLSTTANGTKAFHSVPVSYGESAAI
RRVLAFLVPRVLGF