DBD: Transcription factor prediction database

Release 2.0
www.transcriptionfactor.org
Sequence ID search:
Genome: Ostreococcus sp. RCC809 Sequence ID: jgi|OstRCC809_1|27714|e_gw1.9.270.1
Details Genome DB Domain architecture
External link o8 SF
  o8 PF
SUPERFAMILY (SF) domains
Family name Family Regions Evalue
RING/U-box 57850 103-203 1.07e-07
Pfam (PF) domains
Family name Family Regions Evalue
MIZ zinc finger zf-MIZ 114-166 6.9e-05

Similar transcription factor domain architectures

The domain architectures on these pages may take several minutes to generate. Please be patient.

SUPERFAMILY domain architecture does not contain a sequence specific DNA-binding domain.
Predicted transcription factors with similar Pfam domain combinations.

DNA-binding domain taxonomic distribution

Links to external data on the distribution of DBDs across the tree of life.

No SUPERFAMILY sequence specific DNA-binding domains.
Distribution of MIZ zinc finger DBDs throughout the species in UniProt.

Sequence
MQWPLDVYLTANDHTLSVVKRSTVKSVTKSTRDPAVRIPASRLRSGSNHFRMFHRDRRGAFMIALRIVRK
RSLDEVAACIPRASSETVALKHALKCLGLSKTDDDIIMEDIAVVSLRCPISGHVCEQPARLSGCVGLHTF
DAQSFLRLNTVSRKWSCPECGKKGGPSDLRIDSFLKRCVDIMRERGLHKATRVEMDKDGRWRPREEVGAQ
ALDATQSIWYTPEIAGTKITWKLDTANSSPASTVTKVGVADADSPNVQSIKSEPASAAADAADDDSELDE
EEELKRAIREAAGFSAPNEPAPVKKRAPVPDVIVISDSDDDGPPRRVAAATTKRQKPSSALFRNLPHGRP
P