DBD: Transcription factor prediction database

Release 2.0
www.transcriptionfactor.org
Sequence ID search:
Genome: Ostreococcus sp. RCC809 Sequence ID: jgi|OstRCC809_1|31561|e_gw1.14.634.1
Details Genome DB Domain architecture
External link o8 SF
  o8 PF
SUPERFAMILY (SF) domains
Family name Family Regions Evalue
HLH, helix-loop-helix DNA-binding domain 47459 96-165 5.03e-08
Pfam (PF) domains
Family name Family Regions Evalue
Helix-loop-helix DNA-binding domain HLH 104-155 4.4e-11

Similar transcription factor domain architectures

The domain architectures on these pages may take several minutes to generate. Please be patient.

Predicted transcription factors with similar SUPERFAMILY domain combinations.
Predicted transcription factors with similar Pfam domain combinations.

DNA-binding domain taxonomic distribution

Links to external data on the distribution of DBDs across the tree of life.

Distribution of HLH, helix-loop-helix DNA-binding domain DBDs throughout the major taxonomic superkingdoms and kingdoms.
Distribution of Helix-loop-helix DNA-binding domain DBDs throughout the species in UniProt.

Sequence
MANQTGRVATDEGLIARDDAKVLASNDWLNDFFTHFDGEESPFDIAAAFDVGTGTLASGIQEKPVGVTST
AGEECPKKRKAEDGEEKVEANQAQARSYTLSEGARKTKSTREKRRRDVLNSRFEELIAVLEPGSMMKADK
ATVVVAATQLIKQLRAEHSRLANMIMHFQEDNIRQAESARTLAAERDALVKEKTELLHEKLRIEAQLQGF
LASMPFASPVEGVTAPAAKTMRGNAAWTVPTPFLPANEEAEEDVTLRAPVA