DBD: Transcription factor prediction database

Release 2.0
www.transcriptionfactor.org
Sequence ID search:
Genome: Ostreococcus sp. RCC809 Sequence ID: jgi|OstRCC809_1|34377|e_gw1.33.3.1
Details Genome DB Domain architecture
External link o8 SF
  o8 PF
SUPERFAMILY (SF) domains
Family name Family Regions Evalue
P-loop containing nucleoside triphosphate hydrolases 52540 39-278 7.97e-43
Pfam (PF) domains
Family name Family Regions Evalue
Sigma-54 interaction domain Sigma54_activat 36-260 4.1e-38
Bacterial regulatory protein, Fis family HTH_8 294-330 0.004797

Similar transcription factor domain architectures

The domain architectures on these pages may take several minutes to generate. Please be patient.

SUPERFAMILY domain architecture does not contain a sequence specific DNA-binding domain.
Predicted transcription factors with similar Pfam domain combinations.

DNA-binding domain taxonomic distribution

Links to external data on the distribution of DBDs across the tree of life.

No SUPERFAMILY sequence specific DNA-binding domains.
Distribution of Bacterial regulatory protein, Fis family DBDs throughout the species in UniProt.

Sequence
MPIKEKIHFDTSELARISNIRDSYKNGVIPDFDTPFITDSYKEAYGKALQLAGNSDTTVFIEAEHGTGKS
RLARFIHQKSNRNSRKMFTLNCQAYREDVLENMLFGYESGAFDGAKKLTTGIFEKASGSTVLLKDIDKLS
ERLQIRLLETLQNKTITRLGSSEPKNINVRIIATSTRDLWAMTKEGNFRQDLYHRLCIARLTLPYFTKLS
RKERKEWILHFMELTYAKLEKKYIEQKNIEKKVWDFLLSYSFLGNLQEVVNTVEVLYTFCDKKITFDDIP
KSLLLEKEEGSLLLENVIKSHVQMVVDRYGGNKQQASTILGINRGTVRKYLN