DBD: Transcription factor prediction database

Release 2.0
www.transcriptionfactor.org
Sequence ID search:
Genome: Ostreococcus sp. RCC809 Sequence ID: jgi|OstRCC809_1|41252|fgenesh1_pm.C_scaffold_4000300
Details Genome DB Domain architecture
External link o8 SF
  o8 PF
SUPERFAMILY (SF) domains
Family name Family Regions Evalue
DNase I-like 56219 15-74,107-285 3.35e-42
Pfam (PF) domains
Family name Family Regions Evalue
Endonuclease/Exonuclease/phosphatase family Exo_endo_phos 5-284 7.1e-18
GRF zinc finger zf-GRF 409-460 1.2e-07

Similar transcription factor domain architectures

The domain architectures on these pages may take several minutes to generate. Please be patient.

SUPERFAMILY domain architecture does not contain a sequence specific DNA-binding domain.
Predicted transcription factors with similar Pfam domain combinations.

DNA-binding domain taxonomic distribution

Links to external data on the distribution of DBDs across the tree of life.

No SUPERFAMILY sequence specific DNA-binding domains.
Distribution of GRF zinc finger DBDs throughout the species in UniProt.

Sequence
MYGSLDALLRAFGDDVGVVCFQETKLGDGDGAKAARADGWDGAHSICRAKGKSGYAGVAVYWRLDEVCPL
GIEEGVCGTRMRKNETSTMWPGETPPMATNKRRGEELDDEGRALWVDLDAFVLCTVYVPAVFGDPAKEDK
TADRAAFKADFLRALEERCASLRRRGRAVVVCGDWNIAPSWRRDRAHEKGVGVGVEPRNPSREWLARMLD
DDGGGFRDAFREAHPKTFDAYTCWNIASGAQLHNYGSRIDYFLCDREISMTHVERVGVAQHFEGSDHAPV
FLRLKSPMWRRRRPDQTPPSLAVSALYPGRQTTLRDAFAASERLLSSTAGSTLEYLERASRPDRASRSNK
RKAPEPTMKDFFAVREATPNPNREPPKTTQAPIARATTAAAKSHAVEEWTRAFAKMAPPRCAHGDVCKAR
AVRKRDSPNYGRVFFCCPRPAGPRDNPSCDCGFFAWRDRRSHR