DBD: Transcription factor prediction database

Release 2.0
www.transcriptionfactor.org
Sequence ID search:
Genome: Ostreococcus sp. RCC809 Sequence ID: jgi|OstRCC809_1|43521|fgenesh1_pm.C_scaffold_15000074
Details Genome DB Domain architecture
External link o8 SF
  o8 PF
SUPERFAMILY (SF) domains
Family name Family Regions Evalue
Glucocorticoid receptor-like (DNA-binding domain) 57716 116-160 1.16e-07
Pfam (PF) domains
Family name Family Regions Evalue
GATA zinc finger GATA 122-157 4e-13

Similar transcription factor domain architectures

The domain architectures on these pages may take several minutes to generate. Please be patient.

Predicted transcription factors with similar SUPERFAMILY domain combinations.
Predicted transcription factors with similar Pfam domain combinations.

DNA-binding domain taxonomic distribution

Links to external data on the distribution of DBDs across the tree of life.

Distribution of Glucocorticoid receptor-like (DNA-binding domain) DBDs throughout the major taxonomic superkingdoms and kingdoms.
Distribution of GATA zinc finger DBDs throughout the species in UniProt.

Sequence
MHDHGVCTTAVADAELAMLEASILRSAVPSGCEVMVDGGGAGAGWNADAPCSSGEEGARGRWAPDDVEYE
ECAVSGGFVGGAQDDSASAWERGGVASVAHATTHATTNAVASNGHMKPGGPCDHCGAVDSPQWRRGPASK
PMLCNACGTRYRRTNSLGPAPSSRMATPDKRKNVAQNDARGKKNARCAVGGDNGKFSRARAVVF