DBD: Transcription factor prediction database

Release 2.0
www.transcriptionfactor.org
Sequence ID search:
Genome: Ostreococcus sp. RCC809 Sequence ID: jgi|OstRCC809_1|45693|estExt_Genewise1Plus.C_40774
Details Genome DB Domain architecture
External link o8 SF
  o8 PF
SUPERFAMILY (SF) domains
Family name Family Regions Evalue
FYVE/PHD zinc finger 57903 151-195 6.38e-06
TAZ domain 57933 708-792 7.62e-22
Pfam (PF) domains
Family name Family Regions Evalue
Domain of Unknown Function (DUF902) DUF902 57-108 5.7e-05
PHD-finger PHD 142-191 0.000111
Domain of Unknown Function (DUF906) DUF906 195-464 1.5e-118
Zinc finger, ZZ type ZZ 648-691 0.000119
TAZ zinc finger zf-TAZ 708-787 4.4e-18

Similar transcription factor domain architectures

The domain architectures on these pages may take several minutes to generate. Please be patient.

SUPERFAMILY domain architecture does not contain a sequence specific DNA-binding domain.
Predicted transcription factors with similar Pfam domain combinations.

DNA-binding domain taxonomic distribution

Links to external data on the distribution of DBDs across the tree of life.

No SUPERFAMILY sequence specific DNA-binding domains.
Distribution of TAZ zinc finger DBDs throughout the species in UniProt.

Sequence
MVKGTSGLSKERKPGGEGTSLMECFTPEEIRTHLASLRLADKEKIQGQGQPSARQLQKEAERAVAKATES
SCKACGVERLTFEPPPLYCYSCCSRIKRGQVFHHVPSVVGEVRRDAWCNPCYNAIQGYVNVEGQQFPKQQ
LVKKKNDDDLEEPWVQCDYCEDWYHQICVLFNGRKNEGGSAPFTCPNCILSQLDKGDRKVTLERPSSQQP
ANELPKTKMSTFLEEHLQETLAAEREERAKQLGVPVENVPTAEGLTIRVVSQTMKQVDTKPQYLAAFKDD
GIPAHFPYRSRVILLFQNLDAVDVCLMAIYVQEYDGDCPEPNRRRIYLSYLDSVKYFRPDNVTVATGENC
ALRTYVYHNILIAYLDYAKKRGFTSCFIWACPPFQGDDYILYCHPKVQKTPKADKLREWYLKMLRSAQKR
GIVMSTSNVYDEFRLGNQNHDIRCATEYPYFDGDYFSGIAEDWITSINKELEEAKKLEVKTKASNVKISA
RKAAKAKSGTIAPDAKLNKELMKRLGTTISNMRNDFILAHLAHQCLSCRKTIAGANRYYATEGTPLVLCE
DCKGVEDALPEHEKRYAGRALECEKCEDIPEPIKEEEESEEKMESEFFDTRQAFLSLCQGNHFQFDSLRR
AKHTTMMVLYHLNNPSEPAFVASCNVCSRELEPGKGWRCETCPDFDICDTCRVRVGHQHPLMRQGRTVGD
RSAISEAERQSRQAQIDRTMELLLHAVTCRKNPCDNSNCAKIKQLLNHAFTCQIKTAGGCPLCRKTWTLL
QIHSKQCMDDNCPVPKCKELKEYRRRGQEKIEERRREQYRQYLNAAR