DBD: Transcription factor prediction database

Release 2.0
www.transcriptionfactor.org
Sequence ID search:
Genome: Ostreococcus sp. RCC809 Sequence ID: jgi|OstRCC809_1|49236|estExt_Genewise1Plus.C_170324
Details Genome DB Domain architecture
External link o8 SF
  o8 PF
SUPERFAMILY (SF) domains
Family name Family Regions Evalue
"Winged helix" DNA-binding domain 46785 156-235 1.46e-19
Pfam (PF) domains
Family name Family Regions Evalue
E2F/DP family winged-helix DNA-binding domain E2F_TDP 154-233 2e-32

Similar transcription factor domain architectures

The domain architectures on these pages may take several minutes to generate. Please be patient.

Predicted transcription factors with similar SUPERFAMILY domain combinations.
Predicted transcription factors with similar Pfam domain combinations.

DNA-binding domain taxonomic distribution

Links to external data on the distribution of DBDs across the tree of life.

Distribution of "Winged helix" DNA-binding domain DBDs throughout the major taxonomic superkingdoms and kingdoms.
Distribution of E2F/DP family winged-helix DNA-binding domain DBDs throughout the species in UniProt.

Sequence
MDDEATVDTAALRAILGEENGGDDGGTVATRYDASVDDAFGEPVFGTPDSGERAARGRAGVGAREDDDGR
ERWPRAEVKEEPSREAGPSTVEGRYDPEEAERRCQEAAEVVAEVRRAVARERAANRATASASACATPTPS
RSRKTPATPTTIEREQKGLRHFSMRVCEKVEQKKHTSYNEVADELVDELREASTQNDAKFDEKNVRRRVY
DALNVLMALEIITKKKKEIFWNGYPPGYVKPGESPPRDASGAGPSSRGTPMGMNASDARIDELEKKNEQL
AELVEQHDAIVALVRRNKEALERDNPRPTGIQLPFVLIQTRQDAEVDVEISDDQRKVHFDFNQTPFQIHD
GFHVLTKMINLHERRIPPLTNDQDATAATGAATATAAPTPTPTPTPTKPRKSPAKCPTPTKSPARGKRAK
K