DBD: Transcription factor prediction database

Release 2.0
www.transcriptionfactor.org
Sequence ID search:
Genome: Ostreococcus sp. RCC809 Sequence ID: jgi|OstRCC809_1|49962|estExt_fgenesh1_pg.C_30340
Details Genome DB Domain architecture
External link o8 SF
  o8 PF
SUPERFAMILY (SF) domains
Family name Family Regions Evalue
Ankyrin repeat 48403 19-26,758-853 3.67e-13
Pfam (PF) domains
Family name Family Regions Evalue
CG-1 domain CG-1 89-208 1e-58
Ankyrin repeat Ank 794-826 6.8e-05

Similar transcription factor domain architectures

The domain architectures on these pages may take several minutes to generate. Please be patient.

SUPERFAMILY domain architecture does not contain a sequence specific DNA-binding domain.
Predicted transcription factors with similar Pfam domain combinations.

DNA-binding domain taxonomic distribution

Links to external data on the distribution of DBDs across the tree of life.

No SUPERFAMILY sequence specific DNA-binding domains.
Distribution of CG-1 domain DBDs throughout the species in UniProt.

Sequence
MDRARSSTRKVGIGSMDDEVDADVGTAPARRGRARGAEGRNGGDGLDVGRTRADVGTASVLTRGAVPLRV
DAGTKGVADAATRTRAADIVKNAKTRWLRNTEVCDALLNYVAYGFEASAEAPMKPRAGTLYLINRRVVRF
FRKDGHNWQKKKDGKTVRETHEKLKVGTVELLNCYYTHCEDDPRFQRRCYWLLNMDEGAVLVHYLRVKQH
PARALAAGSAAYAAYAAAMNRKSKGGVVKGAGTKRTTAAGASRSGKSGREQGLTASIHDGEYTAVTRRNV
NEMLQRDDEDLAQIFHETGLDEGDGVWSSIFDPDSSADADGPTTSLSQLMREFSNIDENVDDAHSGRRHL
SSYEDRESPANDDGPVLSLEELERRIERIREQWQGSLSTDKDSQSIKTIDSQMRSLQEDVDRAVEASRRR
AATNTPSDELSGEPSERATPVATDDLSGQGVSPDANGADNDDVCVIERPPSRIFRQIPATPSGVHILWSI
IDFTPSWDDITGGAKVIITGNPLVEFDQEIDMCCVFGTKSVSIERLAPNVLKCEVPPHPPGRVSMFLAMD
NGNGHPVSEMCSFEYVDSAVARSQKNLFASKPVDPSAEMSDRDFQMRLVQLLTTIGSDSSEMSNGKSGEG
TAGSQLMNLYDSVSRSTMHMNALSALRAAERLQIDPYNMDNIKDEDLMVLLNGMIQARLKSVIVHENRRT
KARLAVPTAATAVNELEEVAKVANVAEDDVVGEVVERTQETHKTLMKLALAPSAYNRNDREGLTLFHCCA
ALGIEWAVRAMCATGIDLNHADKHKRTALHWAVARGHEMVVATLLNYGAKSRAVAMWDGHMFGPAELAIH
CGYEGIAAYISEANLTSALDSINLRTNRTSRAPNVSATTHQFRRTMLPSDSDNSDSEGVSFSKSRPRRKA
TRSMLSSKARVRELQVEGSDDSETEAATIVKRAEHARECLLKTLRELNVKPEYVDAQLHAKLGKRRVRRM
KEGEMQNLMSELLTPVGEEPINTQKLTRRPVMRARRLPKGKATQARPKRIEETKETGSSDDDDEEAIQKN
FVRIQSSLQSSAARAQYLRLRRSTHQLRTELRALATASFSDDE