DBD: Transcription factor prediction database

Release 2.0
www.transcriptionfactor.org
Sequence ID search:
Genome: Ostreococcus sp. RCC809 Sequence ID: jgi|OstRCC809_1|52655|estExt_fgenesh1_pm.C_120063
Details Genome DB Domain architecture
External link o8 SF
  o8 PF
SUPERFAMILY (SF) domains
Family name Family Regions Evalue
Homeodomain-like 46689 265-325 6e-06
Homeodomain-like 46689 394-449 9.03e-08
Pfam (PF) domains
Family name Family Regions Evalue
Myb-like DNA-binding domain Myb_DNA-binding 270-324 9.2e-05
Myb-like DNA-binding domain Myb_DNA-binding 399-449 0.000131

Similar transcription factor domain architectures

The domain architectures on these pages may take several minutes to generate. Please be patient.

Predicted transcription factors with similar SUPERFAMILY domain combinations.
Pfam domain architecture does not contain a sequence specific DNA-binding domain.

DNA-binding domain taxonomic distribution

Links to external data on the distribution of DBDs across the tree of life.

Distribution of Homeodomain-like DBDs throughout the major taxonomic superkingdoms and kingdoms.
No PFAM sequence specific DNA-binding domains.

Sequence
MARERAAAETETTAETTAAAAAHASGVGGFGMAVPAPHAYSMMAAFGPKVHELRRQAAMTRGHATTERAP
PMLMFPPVPFNPMTMTMVPPPTVMMPQETAVKVNARHSPSGSDGSHHTTHGADESVERGQEAACSSGRGQ
ASMIAMMMPPPLVLPLSLKNARLEALQVPDRTQTPGIRSPFSAANVLVGMMANGSDKENERSLGQPSRVR
GKRGEYLGPLSVKCPKKRRTTKNSRARSNLKTFDALPAEAPNVAARPLLKSTASNKPKTHRPWSLPEVKA
LVRGVTHYGRGQWADIKALRRDGVADDLINRSAVDLKDKWRNLLRVAMLPGLYKRRDVNGVPSELLEQVR
VLASKSITAPPRRSKDNGVHDQAENAADADVKTEKGLATSKGARRSKHHSPWTMEEAMALVDGVDRCGGC
RWTIIKKCDDPVLERRTAMDLKDKWRNLLQLASLPAQSRRKQETSPEFLQRVLDLEAQYGGARRKGRKTN
SKA