| Details |
Genome |
DB |
Domain architecture |
| External link |
o8 |
SF |
|
| |
o8 |
PF |
|
| SUPERFAMILY (SF) domains |
|
|
|
| Family name |
Family |
Regions |
Evalue |
| Homeodomain-like |
46689 |
12-64 |
6.26e-15 |
| Homeodomain-like |
46689 |
65-135 |
1.32e-21 |
| Homeodomain-like |
46689 |
120-166 |
1.58e-11 |
| Pfam (PF) domains |
|
|
|
| Family name |
Family |
Regions |
Evalue |
| Myb-like DNA-binding domain |
Myb_DNA-binding |
12-59 |
1.9e-14 |
| Myb-like DNA-binding domain |
Myb_DNA-binding |
65-111 |
4.4e-14 |
| Myb-like DNA-binding domain |
Myb_DNA-binding |
117-162 |
8.7e-14 |
Similar transcription factor domain architectures
The domain architectures on these pages may take several minutes to generate. Please be patient.
Predicted transcription factors with similar SUPERFAMILY domain combinations.
Pfam domain architecture does not contain a sequence specific DNA-binding domain.
DNA-binding domain taxonomic distribution
Links to external data on the distribution of DBDs across the tree of life.
Distribution of Homeodomain-like DBDs throughout the major taxonomic superkingdoms and kingdoms.
No PFAM sequence specific DNA-binding domains.
Sequence
GKIGGPTRKSAKGGWTPEEDELLRQAVQVYGGKNWKKIAVYFSDSRTDVQCLHRWQKVLNPELVKGPWTP
EEDARIIKLVTALGPKRWSRIADELPGRIGKQCRERWYNHLDPEIKREEWSVEEDRQLIVAHAEYGNRWA
EIAKSFKGRTDNAIKNHWNSTLKRKVDQALSQGL
| 
