DBD: Transcription factor prediction database

Release 2.0
www.transcriptionfactor.org
Sequence ID search:
Genome: Ostreococcus sp. RCC809 Sequence ID: jgi|OstRCC809_1|87687|eugene1.0000120066
Details Genome DB Domain architecture
External link o8 SF
  o8 PF
SUPERFAMILY (SF) domains
Family name Family Regions Evalue
DNA-binding domain 54171 99-146 9.39e-09
Pfam (PF) domains
Family name Family Regions Evalue
AP2 domain AP2 99-175 1e-06

Similar transcription factor domain architectures

The domain architectures on these pages may take several minutes to generate. Please be patient.

Predicted transcription factors with similar SUPERFAMILY domain combinations.
Predicted transcription factors with similar Pfam domain combinations.

DNA-binding domain taxonomic distribution

Links to external data on the distribution of DBDs across the tree of life.

Distribution of DNA-binding domain DBDs throughout the major taxonomic superkingdoms and kingdoms.
Distribution of AP2 domain DBDs throughout the species in UniProt.

Sequence
MRVGRCNVVRSGERRSLAEAEALGVRVRDWEEQEVRDASRASSVEGPYRRRASASGAFGSLTASTNGRVG
GSPVRADVRQSVHKVARQKGVSSGRTYTSKYRGVHQTFPTGRWEAQFRRNGKPTSLGCFDREEEAAKAYD
RMMLWCELHASLLATTASPQKQGAAALNFDVSTYASELHTLERLSQDDLMQELRRLGRSQASGQRNVASI
FT