DBD: Transcription factor prediction database

Release 2.0
www.transcriptionfactor.org
Sequence ID search:
Genome: Ostreococcus sp. RCC809 Sequence ID: jgi|OstRCC809_1|88161|eugene1.0000130215
Details Genome DB Domain architecture
External link o8 SF
  o8 PF
SUPERFAMILY (SF) domains
Family name Family Regions Evalue
ARID-like 46774 119-199 9.54e-09
FYVE/PHD zinc finger 57903 245-295 2.68e-13
Pfam (PF) domains
Family name Family Regions Evalue
PHD-finger PHD 249-297 4.2e-16
JmjC domain JmjC 435-551 4.4e-36
C5HC2 zinc finger zf-C5HC2 655-708 5.7e-14
PHD-finger PHD 1490-1537 1.5e-11

Similar transcription factor domain architectures

The domain architectures on these pages may take several minutes to generate. Please be patient.

SUPERFAMILY domain architecture does not contain a sequence specific DNA-binding domain.
Predicted transcription factors with similar Pfam domain combinations.

DNA-binding domain taxonomic distribution

Links to external data on the distribution of DBDs across the tree of life.

No SUPERFAMILY sequence specific DNA-binding domains.
Distribution of C5HC2 zinc finger DBDs throughout the species in UniProt.

Sequence
MRAPGACPATSVSVDDDVGKTIDALASIGGRDAGAGKLSTTRGEGESQSKARRSDAFALDLRAWTFEATT
QAVRALGACARDASGELAVPFRDAFERFCARNSSVQAPRGAAWRLHRCGEWRFDLRALYESVKRRGGHDA
IDGNIAWREVAESMGAHGRGCRAGYAARRAHAAWLRAYERETRVEEETARAREYVANARALTEEDKHIID
ALIGLEFGASAPPPKRDEVENGLVHIARQPGDGHEGDATCDVCGAPGDEDAMILCDGCDRGSHMYCLTPK
MTEVPSGEWFCARCRDVDREVALLSEDRGVEFTLAQFNDSCIEFDTAFFGEEAKRVGISMQVIDECFWRM
VEDASSADDVCEVKCGTEIDTTKHGSGFPRRGETLRVKIEGVSADDIKELAESKWNLNNVARASGEHPSV
LASLREDLPGVTTPVLEVGSTFSSTTWRREHHDLYRITYNHWGAPKTWYCVPASAADKFEECFKNVMPDV
YEAHVNDLGRVFTMLSPNFLMNAGVPVNKLEQYPGEYVITFPGAYYATFNCGLNCTESVNYAPTDWLASG
SLSAQRNRLHATPSLFSHEELVCRAADEPSGQTARHLWPEMARIYTEEAQVRNDLFASGVSQSAQLVEPG
EDESNGVRKTRSTGADTSSTPRDSCVVCRQILYLSGVSCSCDDARKACSQHAAELCKCAMSSKTMFYRRT
LADLETLVTKSEKLIPAKELAALKSENAGLGYVAANKGQLKKAQAWVKRVGDELVKPPLPPLQKLKSLLS
GGEEFVWGGSDMKSAREAYARVMNAIAWQTSLVALRQRLGSGSNAEAANDDVSAPRLSLGRLKELLDNPP
VPMPKAETQPLRDLLAAGEKLEERIKAALAEEPNPAPRACSSLQTEANKFGVEVPSYNELKDVIARAGSW
STKVRTALPGRRQLPPRNELANAREIEALFEESSGLPIQQSELLTLRKALEELNFWRAKSESLFAAKVAF
EDADALLKEGMSLSVKLDAVDELGDQIEAVKVWAGRARASDYPQARVGDLKLLLREGENFSVRVDEVEWL
KNRITVRELAEKLKEMIATRQHPLAEVEEAVKQGNEFLDSEDKEVAPDEEALLTQCEAHIEAAKKWNERA
AVMLEAVGSEDPPSLEDASTLIRDGNLCPIALDGFDLLSEAVNTAKSWLERAQPCLKGKQLTRRGASNPI
PPLSEAYELLKESKNLKLYVKEVAGLQERVEDAEDWDVDAQDAVKRWREDGAEVTLNELDVSHEDFGLEL
PGMKMVRIRINSLKWEERVAKVIAPKAKLIDDTVLDELRAQIDELQDLKEDLVAEIIQRHKIVDEWRKKA
DLLLDPPPLEDGRLAPSASPDEIDALIAEGKALPANVSKVEDLETSLADHAVWVETVRKCLNSVAEGRAR
PKIDELYDLLAEVEDLTFKCSERQALTNACNAATAWTEKISSLLWVHDQGDLKTDKTLTEKLMIVLESVK
AAIEDVTGTGEPPETEEGQFCLCRQAGGVQMVGCDDCGDWYHLKCINVTPTMAKTMHNYICPPCMAKSGR
ANQLSLETYRSVHRTSRPNVMLLRELLGEAQRFPGEVPEETILNQVINTHDAWRLEVRKVLHRKSIKESH
ENAIKQAAKIAQAAATRESEERSRRATEAVLSATPENPNPQASLTPLQQVMLMGQAVTFAATQRTHALSV
SPCSPEISEVVTRQLSQLQQLAMQLAMCQAQIHMAPARSRPHILHVLMMQNQHLKMTKDHEQELADVGAS
DWLMQATLQLSGIIPPVVPGENASDRTSKRKR